PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00038.7
Common NameAMTR_s00038p00027320, LOC18442761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 238aa    MW: 26634.8 Da    PI: 6.7867
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00038.7genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.71.4e-3353109259
                             ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                             ++vrYkeClkNhA+s+Ggha+DGCgEfm++ geegt ++lkCaAC+CHRnFHR+e e 
  evm_27.model.AmTr_v1.0_scaffold00038.7  53 SNVRYKECLKNHAVSIGGHAIDGCGEFMAA-GEEGTLESLKCAACNCHRNFHRKEAEG 109
                                             689**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.4E-3054107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2256108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-3056106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.62957106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-29153228IPR009057Homeodomain-like
SuperFamilySSF466897.62E-19160227IPR009057Homeodomain-like
TIGRFAMsTIGR015654.0E-25166222IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDYDDDHDED EEEEIGLPQQ PQDGGDFRNS GRLKMLVPVV SGDSSGSGKR IQSNVRYKEC  60
LKNHAVSIGG HAIDGCGEFM AAGEEGTLES LKCAACNCHR NFHRKEAEGE IPAPQFAAYY  120
RGLPPPASHG PAGYLHVGPS RQSALAITVR EEQEEDGVHA LNPMGKKRFR TKFTQEQKDK  180
MLAFAEKVGW RIQKQDEAEV QRFCMEACIK RHVLKVWMHN NKHTLGKKQH QQDQQQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-231672241875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006853040.11e-180PREDICTED: zinc-finger homeodomain protein 2
SwissprotA2Z2593e-70ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH54e-70ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLU5CZE11e-180U5CZE1_AMBTC; Uncharacterized protein
STRINGVIT_18s0001g07140.t015e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-66homeobox protein 22
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]